<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CMYD-83 04CMYD-83 Cameroon 2005 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, E21K, M36I, R41K, E65K, G68E, H69K, L89M  
>04CMYD-83| codons 16-99
GGQLRKALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILIKICEKKAIGTV
LVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, V35T, E42K, E44K, G45E, R83K, K103R, K122E, I135V, S162A, K173T, Q174K, D177E, I178M, D192N, T200A, R206K, Q207E, R211K  
>04CMYD-83| codons 1-219
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMKKKEKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSNLEIGQHRAKIEELKEHLLKWGFTTPDK

References
Author Title Citation
Ndembi, N Molecular characterization of human immunodeficiency virus type 1 (HIV-1) and HIV-2 in Yaounde, Cameroon: Evidence of major drug resistance mutations in newly diagnosed patients infected with subtypes other than subtype B. J Clin Microbiol, 2008