<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CMYD-66 04CMYD-66 Cameroon 2005 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, K20R, E35D, M36I, R41K, L63C, E65D, H69Q, L89M  
>04CMYD-66| codons 7-99
QRPIVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQICIDI
CGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K122P, I142V, S162C, K173A, Q174K, I178L, Q207G, R211K, T216X, K220X, E224D  
>04CMYD-66| codons 1-227
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRGHLLKWGFTXPDKXHQKDPPF

References
Author Title Citation
Ndembi, N Molecular characterization of human immunodeficiency virus type 1 (HIV-1) and HIV-2 in Yaounde, Cameroon: Evidence of major drug resistance mutations in newly diagnosed patients infected with subtypes other than subtype B. J Clin Microbiol, 2008