<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CMYD-57 04CMYD-57 Cameroon 2005 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4T, V35T, E40D, K49R, V60I, V118I, T139S, S162C, E169D, D177E, I178L, G196E, T200A, E204K, Q207E, R211K, F214L, K223R H221P, Q222E
>04CMYD-57| codons 1-223
PISTIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNESPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPELVI
YQYMDDLYVGSDLEIEQHRAKIEKLREHLLKWGLTTPDKKPER

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, E35D, M36I, N37E, R41K  
>04CMYD-57| codons 13-99
IKVGGQIKEALLDTGADDTVLEDIELPGKWKPKMIGGIGGFIKVRQYDQILIEICGHKAI
GTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Ndembi, N Molecular characterization of human immunodeficiency virus type 1 (HIV-1) and HIV-2 in Yaounde, Cameroon: Evidence of major drug resistance mutations in newly diagnosed patients infected with subtypes other than subtype B. J Clin Microbiol, 2008