<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CMYD-56 04CMYD-56 Cameroon 2005 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G17D, K20R, E35D, M36I, R41K, L63T, H69Q  
>04CMYD-56| codons 8-99
RPVVTVKIGDQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQITIEIC
GQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4H, V35T, E40D, K49R, V60I, V118I, I135T, E138A, S162C, R172K, D177E, I178L, V179I, T200A, E204K, Q207E, R211Q, F214L, K220X, E224X Q182S, H208R
>04CMYD-56| codons 1-227
PISHIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFKKQNPELII
YSYMDDLYVGSDLEIGQHRAKIEKLRERLLQWGLTTPDKXHQKXPPF

References
Author Title Citation
Ndembi, N Molecular characterization of human immunodeficiency virus type 1 (HIV-1) and HIV-2 in Yaounde, Cameroon: Evidence of major drug resistance mutations in newly diagnosed patients infected with subtypes other than subtype B. J Clin Microbiol, 2008