<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CMYD-56 04CMYD-56 Cameroon 2005 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G17D, K20R, E35D, M36I, R41K, L63T, H69Q  
>04CMYD-56| codons 8-99
RPVVTVKIGDQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQITIEIC
GQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Ndembi, N Molecular characterization of human immunodeficiency virus type 1 (HIV-1) and HIV-2 in Yaounde, Cameroon: evidence of major drug resistance mutations in newly diagnosed patients infected with subtypes other than subtype B. J Clin Microbiol, 2008