<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CMYD-24 04CMYD-24 Cameroon 2005 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15X, L19I, E35D, M36I, R41K, I64V  
>04CMYD-24| codons 8-99
RPLVSIKXGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQILVEIC
GHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11E, P14T, V35T, V60I, V106I, V118I, D121Y, K122E, I135T, E138A, S162C, R172K, E204K, Q207E, F214L, E224D  
>04CMYD-24| codons 1-224
PISPIETVPVELKTGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
YEDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFKKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEKLREHLLRWGLTTPDKKHQKD

References
Author Title Citation
Ndembi, N Molecular characterization of human immunodeficiency virus type 1 (HIV-1) and HIV-2 in Yaounde, Cameroon: Evidence of major drug resistance mutations in newly diagnosed patients infected with subtypes other than subtype B. J Clin Microbiol, 2008