<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4014 CA9273 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 3TC+AZT 19
3 3TC+DDI 4
4 None 4
5 3TC+D4T 21
6 3TC+D4T+IDV 34
7 None 20
8 EFV+ADV 10
9 ABC+EFV+ADV 12
10 ADV+DDI+EFV 7
11 DDI+EFV 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, L74LV   L100I, Y188L V179VD A98S, K122A, E169D, G196E, T200A  
>CA9273| codons 1-264
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGIKKKKSVTVLDVGDAYFSVPL
DADFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIDI
YQYMDDLLVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I64V  
>CA9634| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005