<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1469 CA9266 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+AZT 39
3 3TC+AZT+SQV 17
4 3TC+AZT+IDV 52
5 D4T+DDI+NFV 65
6 3TC+RTV+SQV 18
7 3TC+RTV+SQV 5
8 3TC+EFV+RTV+SQV 7

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F K219EQ L100I, K103N   V118I, K122E, I135T, I202V, H208Y, R211K, D218E, L228H, V245Q  
>CA9266| codons 1-264
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQYLLKWGFFTPEEKHQKEPPFHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82A M46V L10I, G16A, N37D, L63P, A71I, V77I, I93L  
>CA9609| codons 1-99
PQITLWQRPIVTIKIAGQLKEALLDTGADDTVLEEMDLPGRWKPKVIVGIGGFSKVRQYD
QIPIEICGHKIIGTVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005