<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T098 NPT98-PL India 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|EFV|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215TI, K219E K103N, Y181C   V35T, E36A, T39E, S48T, V60I, K122E, D123N, I135T, Q174K, D177E, T200A, Q207E, R211K, V245Q, A272P, K281R, L283I, T286A, E291D, V292I, I293V, E312G, V317A, F346H, R356K, G359T  
>NPT98-PL| codons 1-360
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFITPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLIRGAKALTDIVPLTEEAE
LELAENREILKGPVHGAYYDPSKDLIAEIQKQGQGQWTYQIYQEPHKNLKTGKYAKMRTA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, N37K, R41N, L63P, H69K, I93L  
>NPT98-PL| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Sen, S High prevalence of human immunodeficiency virus type 1 drug resistance mutations in antiretroviral treatment-experienced patients from Pune, India. ARHR, 2007