<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T102 NPT102-PL India 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|D4T|NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I15V, L19I, M36I, R41K, K43R, L63P, H69K, I93L  
>NPT102-PL| codons 1-99
PQITLWQRPLVPIKVGGQIKEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V N348I Y181C V108VI V35T, T39E, S48T, K49KR, V60I, D121Y, K122E, D123E, I135R, E169Q, K173E, Q174R, D177E, V179I, T200A, Q207E, R211K, H221Y, V245Q, A272P, K277R, E291D, V292I, I293V, V317A, G335D, R356K, G359T, T377MR, K390R, A400T  
>NPT102-PL| codons 1-403
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
YEEFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILQPFRERNPEIII
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKILKTGKYAKMRTA
HTNDVKQLTEAVQKIARESIVIWGKTPKFRLPIQKETWETWWT

References
Author Title Citation
Sen, S High prevalence of human immunodeficiency virus type 1 drug resistance mutations in antiretroviral treatment-experienced patients from Pune, India. ARHR, 2007