<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T076 NPT76-PL India 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|DDI|NFV|RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L T74P L10I, T12S, L19I, K20R, M36I, K55N, L63P, H69K, A71V, L89M, I93L  
>NPT76-PL| codons 1-99
PQITLWQRPIVSIKIGGQIREALLDTGADDTVLEEINLPGRWKPKLIGGIGGFINVRQYD
QIPIEICGKKVIGPVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, L74V D67G, K219Q     V35T, E36A, T39D, S48T, K64N, D121Y, K122E, I135T, T165I, R172K, K173A, Q174R, D177E, I178L, T200A, E203K, Q207E, R211K, F214L, D218E, Q242QK, V245Q, A272P, K277R, L283I, I293V, G335D, R356K, G359AT, A360AT, V365VI, K390KR, A400T, E404D  
>NPT76-PL| codons 1-406
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPV
FAINKKGSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFKARNPELVI
YQYMDDLYVGSDLEIGQHRAKIKELREHLLKWGLTTPEQKHQKEPPFLWMGYELHPDKWT
VKPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKMRTT
HTNDIKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTDYW

References
Author Title Citation
Sen, S High prevalence of human immunodeficiency virus type 1 drug resistance mutations in antiretroviral treatment-experienced patients from Pune, India. ARHR, 2007