<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T093 NPT93-PL India 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|DDI|IDV|NNRTI|RTV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184MV, T215F K219W G190GA A98G K20R, V35T, T39E, I94L, V118I, D121H, K122E, K166R, K173A, D177E, V179VI, T200A, E203K, Q207E, H208Y, R211K, K223Q, L228H, V245Q, A272P, K277R, L283I, E291D, V292I, I293V, I326V, Q334H, R356K, G359T, A360T, A371V, I375V, T377M, T386I, K390R, E399D, E404D  
>NPT93-PL| codons 1-422
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGLPHPGGLKKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAQNPEIII
YQYVDDLYVASDLEIGQHRAKIKELREYLLKWGFFTPDWKHQQEPPFHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGHGQWTYQIYQEPFKNLKTGKYAKMRTT
HTNDVKQLTEVVQKVAMESIVIWGKIPKFRLPIQKETWDAWWTDYWQATWIPEWEFVNTP
PL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, L90M L23LI, G73ST L10Y, T12S, L19T, K20I, L24LF, R41K, K45KR, K55KR, L63P, H69K, A71V, I72IM, V77I, I93L  
>NPT93| codons 1-99
PQITLWQRPYVSIKIGGQTIEAIFDTGADDTVLEEMNLPGKWKPRIIGGIGGFLRVRQYD
QIPIEICGKKVMTTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Sen, S High prevalence of human immunodeficiency virus type 1 drug resistance mutations in antiretroviral treatment-experienced patients from Pune, India. ARHR, 2007