<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T094 NPT94-PL India 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70R, M184V K219KQ, N348I G190A   V35T, E36EA, T39D, S48ST, V60I, K103R, D121Y, K122E, T139R, S162A, K173A, D177E, Q197K, T200A, Q207G, R211RK, V245Q, A272P, T286A, V292I, I293V, E297KR, V317A, G335D, R356K, G359T, E370EG, T377M, K390R, A400AT, E404D, V435A, L452IM, V466I, D471E, H483Y K102L
>NPT94-PL| codons 1-490
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKLRKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNERPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAQNPEIVI
YQYVDDLYVASDLEIGKHRAKIEELRGHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVPLTREAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKILKTGKYAKMRTA
HTNDVKQLTGAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKMGKAGYVTDRGRQKIVSLTETTNQKTELQ
AIYLALQDSG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L19I, M36I, R41K, L63T, H69K, K70R, I72IT, T74S, L89M, I93L  
>NPT94-PL| codons 1-99
PQITLWQRPLVSIKIGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKRATGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Sen, S High prevalence of human immunodeficiency virus type 1 drug resistance mutations in antiretroviral treatment-experienced patients from Pune, India. ARHR, 2007