<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T112 NPT112-PL India 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|DDI|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, Q151M F116Y, K219Q K103N, Y181C   V35T, E36A, T39E, S48T, V60I, T69N, D121Y, K122E, S134C, I135T, S162A, T165I, K173A, P176T, D177E, V179I, T200A, I202V, E204K, Q207E, R211K, F214L, L228R, V245Q, A272P, K275Q, E291D, V292I, I293V, Q334E, R356K, G359T, T377M, K390R, A400T, E404D Q182H
>NPT112-PL| codons 1-406
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYYSVPL
YEDFRKYTAFTIPCTNNETPGIRYQYNVLPMGWKGSPAIFQASMIKILEPFRAQNTEIII
CHYMDDLYVGSDLEIGQHRAKVEKLREHLLKWGLTTPDQKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIQVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTDYW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, E35D, M36I, R41K, K45R, L63P, H69K, L89M, I93L G94R
>NPT112-PL| codons 1-99
PQITLWQRPLVSIKVGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLRCTLNF

References
Author Title Citation
Sen, S High prevalence of human immunodeficiency virus type 1 drug resistance mutations in antiretroviral treatment-experienced patients from Pune, India. ARHR, 2007