<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T073 NPT73-PL India 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|D4T|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   G190A   V35T, T39D, S48T, V60I, K101Q, K122E, I135T, E138G, K166R, K173A, G196E, T200A, Q207G, R211K, V245Q, D250E, A272P, K277R, K281KR, E291D, V292I, I293V, Q334E, G335D, R356K, G359T, E370ED, T377R, S379C, I382IV, K390R, A400T  
>NPT73-PL| codons 1-402
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNGTPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAQNPDIVI
YQYVDDLYVASDLEIEQHRAKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTDAVQKIARECIVVWGKTPKFRLPIQKETWETWW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, M36I, R41K, Q61E, H69K, L89M, I93L  
>NPT73-PL| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
EILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Sen, S High prevalence of human immunodeficiency virus type 1 drug resistance mutations in antiretroviral treatment-experienced patients from Pune, India. ARHR, 2007