<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3990 CA9242 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 69
2 AZT+ D4T+ DDI 26
3 D4T+ DDI 150

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       V35VI, K43EQ, R83K, K102Q, V118VI, D123DE, E138A, D177E, R211K, E233D  
>CA9242| codons 1-233
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I M36I  
>CA9591| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEINLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001