<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T009 NPT9 India 2004 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 3TC|AZT|RTV|SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14R, I15V, G16E, L19I, M36IV, R41K, Q61H, L63T, H69K, L89M, I93L  
>NPT9| codons 1-99
PQITLWQRPLVSIRVEGQIKEALLDTGADDTVLEEVNLPGKWKPKMIGGIGGFIKVRQYD
HITIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, V60I, D121Y, K122E, D123E, I135R, K173A, D177E, T200A, Q207A, V245Q, D250E, A272P, K277R, K281R, T286A, E291D, V292I, I293V, E297R, V317A, G335D, R356K, G359T, T377M, K390R, A400T, Y405D, T409N, P412T, V435A, A437V, N447S, L452A T362A
>NPT9-PL| codons 1-465
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGAKALTDIVPLTREAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKMRTA
HANDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTEDWQANWITEWEFVNTP
PLVKLWYQLEKEPIAGVETFYVDGAASRETKAGKAGYVTDRGRQK

References
Author Title Citation
Sen, S High prevalence of human immunodeficiency virus type 1 drug resistance mutations in antiretroviral treatment-experienced patients from Pune, India. ARHR, 2007