<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T002 NPT2 India 2004 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 3TC|AZT|DDI|IDV|NNRTI|RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82VA L24I L10I, T12S, I15V, L19I, M36L, N37S, R41K, Q61H, L63P, H69K, L89M, I93L  
>NPT2| codons 1-99
PQITLWQRPIVSIKVGGQIKEALIDTGADDTVLEELSLPGKWKPKIIGGIGGFVKVRQYD
HIPIEICGKKAIGTVLVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M A62V, V75I, F77L, F116Y     V35T, T39D, S68G, D121H, K122E, I135T, K173E, Q174R, D177E, I178L, T200A, Q207N, R211K, V245Q, A272P, K277R, I293V, G335D, R356K, G359T, T386I, K390R, K395R, A400T  
>NPT2-PL| codons 1-401
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKISKIGPENPYNTPV
FVIKKKDGTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRERNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQRETWETW

References
Author Title Citation
Sen, S High prevalence of human immunodeficiency virus type 1 drug resistance mutations in antiretroviral treatment-experienced patients from Pune, India. ARHR, 2007