<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA799 CA9230 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 261
2 DDI 65
3 AZT+DDI 52
4 3TC+AZT 48
5 D4T+DDC+RTV 31
6 D4T+DDC+IDV 13
7 3TC+AZT+RTV+SQV 13
8 D4T+NFV+NVP 9
9 3TC+AZT+D4T+IDV 14
10 3TC+AZT+DDI+RTV+SQV 27
11 3TC+AZT+IDV+RTV 8
12 3TC+ABC+AZT+Unknown 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, M184V, L210W, T215Y D67E, K219N K103N, Y181C A98G V35M, K43KQ, E44D, S68G, K122E, I135T, D177E, V179I, G196E, E203K, Q207E, V245M, A272P, V276I N265NT
>CA9230| codons 1-278
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEQDGKISKIGPENPYNTPV
FAIKKKEGTKWRKLMDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
CQYVDDLYVGSDLEIEQHRTKIKELREHLWRWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLTWASQIYPGIKIKQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M G73S L10I, I15V, K20M, E35D, M36I, R57K, I62V, L63P, A71V  
>CA9581| codons 1-99
PQITLWQRPIVTIKVGGQLMEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVKQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005