<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3978 CA9225 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 57
2 3TC+AZT 22
3 3TC+AZT+IDV 74
4 DDI+NFV+NVP 56

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LV, L210W, T215Y   K103N, Y181C   E28K, V35I, T39A, K43E, E44ED, V118I, K122KE, I135T, I142V, G196E, R211K, V245Q  
>CA9225| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALIEICAELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M F53L, G73S L10I, I13IV, N37D, K55R, L63P, H69HR, A71V, I93L  
>CA9552| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGLVRVRQYD
QIPIEICGRKVISTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005