<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
D0082 05CN_082 China 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K101E, G190S   I135V, S162D, T200A  
>05CN_082| codons 1-254
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   K20I, L63P, I72V, V77I, I93L  
>05CN_082| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Zhong, P Genetic diversity and drug resistance of human immunodeficiency virus type 1 (HIV-1) strains circulating in Shanghai. ARHR, 2007