<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
D0070 05CN_070 China 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, K43Q, K49R, V60I, K122E, D123S, E138A, K173T, Q174K, D177E, Q207A, R211K, V241A, V245Q, E248D, D250E, S251N, I257L  
>05CN_070| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICTEMEQEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
AQPIQLPDKENWTVNDLQK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, E35D, M36I, N37S, R41K, H69Q, L89M  
>05CN_070| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEDISLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Zhong, P Genetic diversity and drug resistance of human immunodeficiency virus type 1 (HIV-1) strains circulating in Shanghai. ARHR, 2007