<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
D0052 05CN_052 China 2005 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, E35D, M36I, Q61E, L63P, I64L, C67S, H69K, V82I, L89M, I93L  
>05CN_052| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
EIPLEISGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   K103N, Y181C V179E K20R, V35T, T39N, E40D, V60I, K122E, D123N, K173T, Q174K, D177E, I178L, T200A, Q207E, F214L, V245Q, E248D  
>05CN_052| codons 1-259
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICNDMEKEGKISKIGPENPYNTPI
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPELEI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQK

References
Author Title Citation
Zhong, P Genetic diversity and drug resistance of human immunodeficiency virus type 1 (HIV-1) strains circulating in Shanghai. ARHR, 2007