<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
D0049 05CN_049 China 2005 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   Y181C, G190S   E6D, K11T, K32R, V35T, T39K, K43E, K122E, D123K, K173V, Q174K, D177E, V179T, T200I, I202V, Q207D, R211K, K238R, V245Q G231E
>05CN_049| codons 1-259
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIRALTEICKEMEEEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEKFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRVKNPEITI
CQYMDDLYVSSDLEIGQHRIKVEELRDHLLKWGFTTPDKKHQKEPPFLWMEYELHPDRWT
VQPIQLPEKDSWTVNDIQK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, E35D, M36I, R41K, H69K, L89M  
>05CN_049| codons 1-99
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Zhong, P Genetic diversity and drug resistance of human immunodeficiency virus type 1 (HIV-1) strains circulating in Shanghai. ARHR, 2007