<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
D0022 05CN_022 China 2005 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M F116Y K103N A98G E6D, K11T, K20R, V35T, T39E, S68G, K122E, D123S, I135L, E138G, R172K, K173A, Q174K, D177E, I178M, T200I, Q207A, R211S, V245E V241C
>05CN_022| codons 1-257
PISPIDTVPVTLKPGMDGPRVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYYSVPL
DESFRKYTAFTIPSLNNGTPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFKAKNPEMVI
YQYMDDLYVGSDLEIGQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
CQPIELPEKDSWTVNDI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>05CN_022| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Zhong, P Genetic diversity and drug resistance of human immunodeficiency virus type 1 (HIV-1) strains circulating in Shanghai. ARHR, 2007