<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3963 CA9202 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 AZT+DDC 34
3 D4T+DDI+RTV+SQV 26
4 D4T+DDI+IDV 69
5 3TC+AZT+NFV+NVP 77

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   Y188L   V21I, K43N, E44D, K102KR, V118I, K122E, I135T, S162C, V189VI, R211K, E224ED F130FL
>CA9202| codons 1-257
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSIPL
DEDFRKYTALTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLLIGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKDPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10I, I13V, K14R, K20T, L63P, A71V, V77VI  
>CA9547| codons 1-99
PQITLWQRPIVTVRIGGQLTEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLIGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009