<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1808 CA9179 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 143
2 DDI 169
3 D4T+3TC+IDV 61
4 3TC+AZT+DDI+IDV 8
5 AZT+3TC+NVP+NFV 78
6 ABC+EFV+RTV+SQV 22

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y D67G, K219N L100I, K103N   E6D, K20R, E44ED, S68G, V118I, I135V, S162C, T200A, D218DE, H221HY, V245M, A272P, K281R, T286A  
>CA9179| codons 1-304
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTPENKYQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVIPLTEEAE
LELA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, I15V, K20I, M36I, R41K, I62V, L63P, I72L, I93L  
>CA9707| codons 1-99
PQITLWQRPIVTIKVGGQLIEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYD
QVPIEICGHKALSTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005