<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
28 28HIV-SEY Seychelles 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, R41K, I64L, H69K, V82I, L89M  
>28HIV-SEY| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILLEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V90I, I135V, S162A, F171FL, K173T, Q174K, D177E, I178M, T200A, Q207E, H208Y, R211K I180IT
>28HIV-SEY| codons 6-234
ETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPVFAIKK
KDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFR
KYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPLRTKNPEMVTYQYMD
DLYVGSDLEIGQHRAKIEELREYLLKWGFTTPDKKHQKEPPFLWMGYEL

References
Author Title Citation
Razafindratsimandresy, R HIV type 1 diversity in the Seychelles. ARHR, 2007