<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
9 9HIV-SEY Seychelles 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, L63P, H69K, T74A, L89M, I93L  
>9HIV-SEY| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGAVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35T, E36A, T39E, S48T, V60I, K122E, D123S, T165I, K173A, D177E, I178M, T200A, Q207E, R211K, V245K, D250E  
>9HIV-SEY| codons 6-250
ETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPIFAIKK
KDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDESFR
KYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRAQNPEMVIYQYMD
DLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIK
LPEKE

References
Author Title Citation
Razafindratsimandresy, R HIV type 1 diversity in the Seychelles. ARHR, 2007