<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8 8HIV-SEY Seychelles 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, Q18QE, L19LI, E35D, M36I, R41K, R57K, L63P, H69K, V77I, L89M  
>8HIV-SEY| codons 1-99
PQITLWQRPLVTVKIGGEIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGKKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39TA, E40ED, V60I, K104KR, K122E, D123N, I135IT, T165TI, K173LS, Q174K, D177E, V179VI, T200TI, Q207A, R211S, V245E, D250E  
>8HIV-SEY| codons 6-250
ETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPIFAIKK
KDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPLDENFR
KYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRSKNPEIIIYQYMD
DLYVGSDLEIGQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIE
LPEKE

References
Author Title Citation
Razafindratsimandresy, R HIV type 1 diversity in the Seychelles. ARHR, 2007