<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TRC24 TRC24 India 2007 HIV1 C Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TS, I15V, L19T, M36T, R41K, L63P, H69K, V77I, L89M, I93L  
>TRC24| codons 1-99
PQITLWQRPLVSIKVGGQTKEALLDTGADDTVLEETNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11E, K20R, V35T, T39E, S48T, V60I, D121Y, K122E, D123E, I135R, S162A, K173T, D177E, T200TA, Q207E, V245Q, K249N D76DY, D110DY, Q222QL
>TRC24| codons 3-255
SPIETVPVELKPGMDGPRVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPIFA
IKKKDSTKWRKLVYFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLYVGDAYFSVPLYE
EFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPEIVIYQ
YMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHLKEPPFLWMGYELHPDKWTVQ
PIQLPENDSWTVN

References
Author Title Citation
Soundararajan, L Characterization of HIV-1 isolates from antiretroviral drug-naive children in southern India. ARHR, 2007