<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TRC14 TRC14 India 2007 HIV1 C Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F T12S, K14R, L19I, M36I, R41K, L63S, H69K, L89M, I93L  
>TRC14| codons 1-99
PQITLWQRPLVSIRIGGQIKEALLDTGADDTVFEEINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, S48T, D86E, D121Y, K122E, S162A, R172K, K173A, Q174K, D177E, I178IM, Q197H, T200A, Q207E, V245Q, K249N  
>TRC14| codons 1-255
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFKAKNPEMVI
YQYMDDLYVGSDLEIGHHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPENDSWTVN

References
Author Title Citation
Soundararajan, L Characterization of HIV-1 isolates from antiretroviral drug-naive children in southern India. ARHR, 2007