<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1461 1461b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 56

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   I37X, D123E, I135V, K173E, D177E, H221Y, V245Q  
>1461b| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFREQNPEIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTT
PDKKYQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    P39S, R41K, D60E, L63P, A71T, V77I  
>1461b| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLSGKWKPKMIGGIGGFIKVRQYEQIP
IEICGHKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003