<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_3763 3763c U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 46
2 D4T+DDI+EFV 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L   L63A, V77I  
>3763c| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFLKVRQYDQIA
IEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62AV K103N K238KT I37X, I135T, R211K, L228LR, V245E  
>3763c| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTT
PDKKHQKEPPFRWMGYELHPDTWTVQPIELP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003