<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0783 0783b U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, E35D, M36I, R41K, R57K, L89M  
>0783b| codons 4-99
TLWQRPLVTIRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIL
IEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KT   I37X, T39TA, K49KR, R83RK, K173KN, Q174R, I178M, T200TA, R211K, V245K M41MIR, E42E*GW
>0783b| codons 37-247
VCAERWKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPH
PAGLKKTKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRNRNPDMVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003