<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1744 1744b U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I13V, E35D, K43R, I62V, L63P, L90LF, I93L  
>1744b| codons 4-99
TLWQRPLVAVKIGGQLKEALLDTGADDTVLEDMNLPGRWRPKMIGGIGGFIKVRQYDQVP
IEICGHKAIGTVLVGPTPVNIIGRNLFTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101E, K103N   D123E, I142V, T200E, Q207G, V245K  
>1744b| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHREKIEELRGHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003