<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_3210 3210b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 25

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215TFIS K219Q     E6D, K20R, V35T, K122E, E138A, T200K, Q207N, R211RK, A272G, I293V E42EA
>3210b| codons 1-303
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMAKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRKKIEELRNHLLKWGFSTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYGGIKVKQLCKLLRGTKALTEVVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M G73S L10I, I15V, K20I, E35D, K45R, L63P, A71V, I72L  
>3210b| codons 1-99
PQITLWQRPIVTIKVGGQLIEALLDTGADDTVLEDMNLPGRWKPRMIGGIGGFIKVRQYD
QIPIEICGHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003