<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_6657 6657b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV+NFV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TS, N37D, I62IV, L63S, I64IM, V77I  
>6657b| codons 4-99
TLWQRPLVSIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYDQVS
MEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V118I, K122E, D123G, T139R, I142T, T165I, V189I, G196E, R211G, F214L A129AE
>6657b| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEGFRKYTEFTIPSINNERPGTRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKQNPDIVIYQYVDDLYIGSDLEIEQHRTKIEELRQHLLGWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003