<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_5727 5727b U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 125

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   V35T, V60I, R83K, D123E, I135T, D177E, T200A, Q207E, R211K, H221Y, V245E K13KN
>5727b| codons 1-253
PISPIETVPVKLNPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12E, K14R, L63T, V77I  
>5727b| codons 1-99
PQITLWQRPLVEIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003