<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_4092 4092c U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 20
2 3TC+AZT+NFV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   T12P, K14R, E35D, M36I, N37D, L63P, I93L  
>4092c| codons 1-99
PQITLWQRPLVPIRIGGQLKEALLDTGADNTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   K43N, I135T, F171Y, T200A, R211K, F214L, V245M, E248D, A272P, T286A  
>4092c| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003