<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_4079 4079b U.S. 2000 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 30
2 3TC+AZT+EFV 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S L33LF L10I, I15V, K20KT, E35D, M36I, R41K, R57K, Q61N, L63T, E65D, L89M  
>4079b| codons 1-99
PQITLWQRPIVTIKVGGQLTEALLDTGADDTVFEDINLPGKWKPKMIGGIGGFIKVKQYD
NITIDICGHKAIGTVLVGPTPVNIIGRSMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR D67DG     V35T, K49R, V106VI, K122KE, I135V, S162C, E169D, K173A, Q174K, T200A, Q207E, R211RK, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, E297A, S322T  
>4079b| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPV
FAIKRKGSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPTKD

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003