<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3910 CA9112 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 72
2 AZT+ D4T 29
3 3TC+ SQV+ AZT 67
4 D4T+ 3TC+ NFV 32
5 RTV+ SQV+ NVP 63

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W T215C Y181C, G190A   E6EK, K20R, V35T, T39A, K43Q, E44D, K102Q, K122E, Q207E, H208Y, R211K, T286P, I293V, P294Q, E297K  
>CA9112| codons 1-303
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELREYLWKWGFCTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGPKALTEVVQLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V, L90M L23I L10I, P39A, L63P, A71V, V77I  
>CA9686| codons 1-99
PQITLWQRPIVTIKIGGQLKEAILDTGADDTVLEEMNLAGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLIGPTPANVIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005