<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1464 1464b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV+NFV 19
2 None 3
3 D4T+DDI+EFV+NFV 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L33LF W6WS, I62V, L63P, I64L  
>1464b| codons 4-99
TLSQRPLVTIKIGGQLKEALLDTGADNTVFEEMNLPGRWKPKMIGGIGGFIKVRQYDQVP
LEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75VI K103N, Y188YH P225PH I37X, R83K, D121Y, K122E, G196E, R211K, I244V, V245T  
>1464b| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPH
PAGLKKNKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPDIVIYQYMDDLHVGSDLEIEQHRTKIEELRQHLLKWGFTT
PDKKHQKEHPFLWMGYELHPDKWTVQPVTLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003