<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_0132 0132b U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV+NFV 105
2 None 7
3 D4T+DDI+EFV+NFV 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37C, L63P, I72IV, V77I, I93L  
>0132b| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D123E, S162C, D177DE, I178IM, Q207K, R211E  
>0132b| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPEMVIYQYMDDLYVGSDLEIGQHRTKIEELRKHLLEWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003