<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_1627 1627a U.S. 1999 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, I13V, E35D, M36I, R41K, R57K, L63LP, I64IM, H69K, L89M  
>1627a| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIP
MEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K49KR, V60I, D121DH, K122E, D123S, I135T, K173V, Q174K, D177E, T200A, Q207A, R211S, V245K I37IFLV
>1627a| codons 37-247
VCTEMEKEGKISRIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRVKNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003