<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1596 CA9099 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 8
2 AZT+ 3TC 28
3 IDV+ AZT+ 3TC 11
4 IDV+ D4T+ 3TC 51
5 RTV+ DDC+ NVP 19
6 SQV+ D4T+ AZT 31
7 DDI+ D4T 19
8 DDI+ ABC 6

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   T69N, D123E, I142V, I180V, G196E, T200A, E203K, L228LH, K277R, T286A, E297K  
>CA9099| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVV
CQYMDDLYVGSDLEIEQHRAKIKELRQHLLRWGFTTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37T, L63P, I72V  
>CA9678| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMTLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012