<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_3918 3918c U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 19
2 D4T+DDI+EFV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12S, N37C, I62V, L63C  
>3918c| codons 4-99
TLWQRPIVSIKIGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYDQVC
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, V106A P225H I37X, K122E, I135V, I142V, D177E, G196R, T200A, R211K  
>3918c| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKNKSATVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIRQHRAKIEELRQHLLKWGFTT
PDKKHQKEHPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003