<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_3918 3918b U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 19

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    W6WG, L10V, T12P, N37CS, I62V, L63AS, I64M D29DV
>3918b| codons 4-99
TLGQRPVVPIKIGGQLKEALLDTGAVDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQVS
MEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103T   I37X, K122E, I135V, I142IV, D177E, G196GR, T200TA, R211K  
>3918b| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKTKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIRQHRAKIEELRQHLLKWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003