<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3896 CA9094 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 126
2 3TC+AZT 22
3 3TC+AZT+IDV 26
4 AZT+DDI+NVP+RTV+SQV 30
5 3TC+DDI+SQV 43
6 ABC+DDI+EFV+SQV 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74IV, T215FI K219Q K103N, Y181C, G190A   D17DE, K20R, E169D, Q207H, R211K, D218E, A272P  
>CA9094| codons 1-303
PISPIETVPVKLKPGMEGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRHHLLKWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M   L10I, E35D, M36I, R41K, D60E, I62V, L63P, I64V, I93L  
>CA9647| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYE
QVPVEICGHKAIGTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001