<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A384_2581 2581c U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV+NFV 131
2 3TC+D4T+EFV+NFV 6
3 None 6

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37D, L63S, I64V, E65D, V82VI  
>2581c| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYDQIS
VDICGHKAIGTVLVGPTPINIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L K219KR     V60I, T200K, R211K, T215X, V245M E53E*, D113DN
>2581c| codons 38-247
CTELEKEGKISKIGP*NPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGNAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRKKIEELRQHLLKWGFXTP
DRKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Shafer, RW Comparison of four-drug regimens and pairs of sequential three-drug regimens as initial therapy for HIV-1 infection. N Engl J Med, 2003