<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1422 CA9088 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 29
2 None 14
3 AZT 2
4 None 7
5 DDI 23
6 None 3
7 DDI 4
8 AZT+DDC 6
9 DDC 8
10 None 9
11 DDI 8
12 None 21
13 D4T 4
14 None 23
15 D4T 15
16 3TC+D4T 37
17 3TC+NVP 4
18 3TC+D4T 40
19 DDC+NFV+SQV 27
20 EFV+NFV+SQV 8
21 EFV+NFV 6
22 D4T+EFV+NFV 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190S   E6K, V35M, R83K, K122E, K166R, T200I, V245E, A272P, K277R  
>CA9088| codons 1-283
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVSSDLEIGQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L63P  
>CA9486| codons 10-99
LVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGH
KAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005